PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0002s0085.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 376aa    MW: 41713.5 Da    PI: 4.8587
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0002s0085.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.72.6e-3392146155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+rlrWt++LH+rFveav+qLGG+++AtPk +l++m+v gLt++hvkSHLQkYRl
  Kalax.0002s0085.1.p  92 KQRLRWTNDLHDRFVEAVAQLGGPDRATPKGVLRVMGVSGLTIYHVKSHLQKYRL 146
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.90889149IPR017930Myb domain
SuperFamilySSF466891.77E-1791146IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.1E-3291147IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-2692147IPR006447Myb domain, plants
PfamPF002496.3E-994145IPR001005SANT/Myb domain
PfamPF143792.2E-23177223IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MRVYVDFGVD KEHFNPTFLV DLIEFVMEEV GGSSVSYCWV FDGCAEMRAT PLDLASEKSS  60
AQGKPSHGRE SNMEPGGGDS NNQSSNPNLA SKQRLRWTND LHDRFVEAVA QLGGPDRATP  120
KGVLRVMGVS GLTIYHVKSH LQKYRLAKYL PDSSSDGKVE NKESGDTGSS QDGSAGMQIT  180
EALKLQMEVQ KRLHEQLEVQ RQLQLRIEAQ GKYLKKIIEE QQRLGVFTLE EDPAPATDIP  240
QSNNSKIDSA GPGPASRFSL EDKSKNLFTD IRHFVDEAFP YLQEPLTPDS ACDRNSPTES  300
LKDDQPFKKQ RLSVNMNEPF DRPENEVSPQ MVEGLTPLHQ QPSSGPFTQL QFDLTPGISV  360
RDEDRAEKLP GGSYL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010647087.11e-109PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_010647086.11e-109PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_010647085.11e-109PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_002272588.21e-109PREDICTED: protein PHR1-LIKE 1-like isoform X1
TrEMBLA5C9661e-109A5C966_VITVI; Putative uncharacterized protein
TrEMBLF6HD661e-109F6HD66_VITVI; Putative uncharacterized protein
STRINGVIT_00s0475g00040.t011e-109(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.15e-80G2-like family protein